Recombinant Human SEC24D protein (ab160692)

Overview

  • Product name
    Recombinant Human SEC24D protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYS MKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN
    • Amino acids
      935 to 1032
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0755
    • Protein transport protein Sec24D
    • SC24D_HUMAN
    • SEC24 family member D
    • SEC24 related gene family, member D
    • SEC24-related protein D
    • SEC24D
    see all
  • Function
    Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.
  • Tissue specificity
    Ubiquitously expressed, with higher amounts in placenta, pancreas, heart and liver.
  • Sequence similarities
    Belongs to the SEC23/SEC24 family. SEC24 subfamily.
  • Cellular localization
    Cytoplasm. Cytoplasm > perinuclear region. Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160692 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up