Recombinant Human SECISBP2L protein (ab160629)

Overview

  • Product name
    Recombinant Human SECISBP2L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDRAPTEQNVKLSAEVEPFIPQKKSPDTFMIPMALPNDNGSVSGVEPTPI PSYLITCYPFVQENQSNRQFPLYNNDIRWQQPNPNPTGPYFAYPIISAQP PVSTEYTYYQLMPAPCAQVMGFYHPFPTPYSNTFQAANTVNAITTECTER PSQLGQVFPLSSHRSRNSNRGSVVPKQQLLQQHIKSKRPLVKNVATQKET NAAGPDSRSKIVLLVDASQQTDFPSDIANKSLSETTATMLWKSKGRRRRA SHPTAESSSEQGASEADIDSDSGYCSPKHSNNQPAAGALRNPDSGTMNHV ESSMCAGGVNWSNVTCQATQKKPWMEKNQTFSRGGRQTEQRNNSQDEDGF QELNENGNAKDENIQQKLSSKVLDDLPENSPINIVQTPIPITTSVPKRAK SQKKKALAAALATAQEYSEISMEQKKLQEALSKAAGKKNKTPVQLDLGDM LAALEKQQQAMKARQITNTRPLSYTVVTAASFHTKDSTNRKPLTKSQPCL TSFNSVDIASSKAKKGKEKEIAKLKRPTALKKVILKEREEKKGRLTVDHN LLGSEEPTEMHLDFIDDLPQEIVSQEDTGLSMPSDTSLSPASQNSPYCMT PVSQGSPASSGIGSPMASSTITKIHSKRFREYCNQVLCKEIDECVTLLLQ ELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEK IQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIF NYFGAESLFNKLVELTEEARKAYKDMVAAMEQEQAEEALKNVKKVPHHMG HSRNPSAASAISFCSVISEPISEVNEKEYETNWRNMVETSDGLEASENEK EVSCKHSTSEKPSKLPFDTPPIGKQPSLVATGSTTSATSAGKSTASDKEE VKPDDLEWASQQSTETGSLDGSCRDLLNSSITSTTSTLVPGMLEEEEDED EEEEEDYTHEPISVEVQLNSRIESWVSETQRTMETLQLGKTLNGSEEDNV EQSGEEEAEAPEVLEPGMDSEAWTADQQASPGQQKSSNCSSLNKEHSDSN YTTQTT
    • Amino acids
      1 to 1056
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3110001I20Rik
    • AI504340
    • C630011I23
    • KIAA0256
    • RGD1559930
    • RP23-367K9.1
    • SBP2L_HUMAN
    • SECIS-binding protein 2-like
    • SECISBP2L
    • Selenocysteine insertion sequence-binding protein 2-like
    see all
  • Information by UniProt

Images

  • ab160629 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up