Recombinant Human SECTM1 protein (ab116893)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ8WVN6
    • SpeciesHuman
    • SequenceQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIF NEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQ VTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRR EKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPS PLGALELLSPQPLFPYAADP
    • Molecular weight50 kDa including tags
    • Amino acids29 to 248

Specifications

Our Abpromise guarantee covers the use of ab116893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • K12
    • K12 protein
    • Protein K-12
    • Protein K12
    • SCTM1_HUMAN
    • Secreted and transmembrane 1
    • Secreted and transmembrane protein 1
    • SECTM 1
    • SECTM1
    • Type 1a transmembrane protein
    see all
  • FunctionMay be involved in thymocyte signaling.
  • Tissue specificityDetected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic epithelial cells and fibroblasts.
  • Sequence similaritiesBelongs to the SECTM family.
  • Cellular localizationCell membrane. Secreted.
  • Information by UniProt

Recombinant Human SECTM1 protein images

  • 12.5% SDS-PAGE showing ab116893 at approximately 50.31kDa stained with Coomassie Blue.

References for Recombinant Human SECTM1 protein (ab116893)

ab116893 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"