Recombinant Human SECTM1 protein (ab116893)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIF NEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQ VTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRR EKKFFLLEPQMKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPS PLGALELLSPQPLFPYAADP
    • Molecular weight
      50 kDa including tags
    • Amino acids
      29 to 248

Specifications

Our Abpromise guarantee covers the use of ab116893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • K12
    • K12 protein
    • Protein K-12
    • Protein K12
    • SCTM1_HUMAN
    • Secreted and transmembrane 1
    • Secreted and transmembrane protein 1
    • SECTM 1
    • SECTM1
    • Type 1a transmembrane protein
    see all
  • Function
    May be involved in thymocyte signaling.
  • Tissue specificity
    Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic epithelial cells and fibroblasts.
  • Sequence similarities
    Belongs to the SECTM family.
  • Cellular localization
    Cell membrane. Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116893 at approximately 50.31kDa stained with Coomassie Blue.

References

ab116893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up