Recombinant Human SECTM1 protein (ab184895)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIF NEVAPGYFSR DGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNN RQVTLEVSGAEPQSAPDTG
    • Molecular weight
      14 kDa including tags
    • Amino acids
      29 to 145
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain. AAH17716.

Specifications

Our Abpromise guarantee covers the use of ab184895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 92 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • K12
    • K12 protein
    • Protein K-12
    • Protein K12
    • SCTM1_HUMAN
    • Secreted and transmembrane 1
    • Secreted and transmembrane protein 1
    • SECTM 1
    • SECTM1
    • Type 1a transmembrane protein
    see all
  • Function
    May be involved in thymocyte signaling.
  • Tissue specificity
    Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic epithelial cells and fibroblasts.
  • Sequence similarities
    Belongs to the SECTM family.
  • Cellular localization
    Cell membrane. Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab184895, stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 23-26 kDa due to glycosylation.

References

ab184895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up