Recombinant Human Securin protein (ab116478)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95997
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMATLIYVDKENGEPGTRVVAKDGLKLGSGP SIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRATEKSVKTKGP LKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPFNPLDFESFDL PEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQ SPSSILSTLDVELPPVCCDIDI
    • Molecular weight24 kDa including tags
    • Amino acids1 to 202
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 80 % SDS-PAGE.
    ab116478 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesalthough stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • AW555095
    • C87862
    • Cut2
    • EAP 1
    • EAP1
    • ESP1 associated protein 1
    • Esp1-associated protein
    • hPTTG
    • MGC126883
    • MGC138276
    • Pds1
    • Pituitary tumor transforming 1
    • Pituitary tumor transforming protein 1
    • Pituitary tumor-transforming 1, isoform CRA_a
    • Pituitary tumor-transforming 1, isoform CRA_b
    • Pituitary tumor-transforming gene 1
    • Pituitary tumor-transforming gene 1 protein
    • PTTG
    • PTTG 1
    • PTTG1
    • PTTG1 protein
    • PTTG1_HUMAN
    • Pttg3
    • Securin
    • Tumor transforming 1
    • Tumor transforming protein 1
    • Tumor-transforming protein 1
    • TUTR 1
    • TUTR1
    see all
  • FunctionRegulatory protein, which plays a central role in chromosome stability, in the p53/TP53 pathway, and DNA repair. Probably acts by blocking the action of key proteins. During the mitosis, it blocks Separase/ESPL1 function, preventing the proteolysis of the cohesin complex and the subsequent segregation of the chromosomes. At the onset of anaphase, it is ubiquitinated, conducting to its destruction and to the liberation of ESPL1. Its function is however not limited to a blocking activity, since it is required to activate ESPL1. Negatively regulates the transcriptional activity and related apoptosis activity of TP53. The negative regulation of TP53 may explain the strong transforming capability of the protein when it is overexpressed. May also play a role in DNA repair via its interaction with Ku, possibly by connecting DNA damage-response pathways with sister chromatid separation.
  • Tissue specificityExpressed at low level in most tissues, except in adult testis, where it is highly expressed. Overexpressed in many patients suffering from pituitary adenomas, primary epithelial neoplasias, and esophageal cancer.
  • Sequence similaritiesBelongs to the securin family.
  • Developmental stageLow level during G1 and S phases. Peaks at M phase. During anaphase, it is degraded.
  • DomainThe N-terminal destruction box (D-box) acts as a recognition signal for degradation via the ubiquitin-proteasome pathway.
    The TEK-boxes are required for 'Lys-11'-linked ubiquitination and facilitate the transfer of the first ubiquitin and ubiquitin chain nucleation. TEK-boxes may direct a catalytically competent orientation of the UBE2C/UBCH10-ubiquitin thiolester with the acceptor lysine residue.
  • Post-translational
    modifications
    Phosphorylated at Ser-165 by CDK1 during mitosis.
    Phosphorylated in vitro by ds-DNA kinase.
    Ubiquitinated through 'Lys-11' linkage of ubiquitin moieties by the anaphase promoting complex (APC) at the onset of anaphase, conducting to its degradation. 'Lys-11'-linked ubiquitination is mediated by the E2 ligase UBE2C/UBCH10.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

References for Recombinant Human Securin protein (ab116478)

ab116478 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"