Overview

  • Product name
    Recombinant Human SELS protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQK LSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKH KEKLKQLEEEKRRQKIEVWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLK RKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG*G
    • Amino acids
      1 to 189
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AD-015
    • ADO15
    • MGC104346
    • MGC2553
    • SBBI8
    • selenoprotein S
    • SEPS1
    • VCP interacting membrane protein
    • VCP-interacting membrane
    • VIMP
    see all
  • Relevance
    Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin dependent manner. Probably acts by serving as a linker between DERL1, which mediates the retrotranslocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination.
  • Cellular localization
    Endoplasmic reticulum; endoplasmic reticulum membrane; single pass membrane protein.

Images

  • ab163245 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up