Recombinant Human SEMA4F protein (ab161030)

Overview

  • Product name
    Recombinant Human SEMA4F protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEA DSCLTRFAVPHTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRI DWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADLLCPGPEHGRA SSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLN GPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVL TFIRDHPLMDRPVFPADGHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYL GTEDGHLHRAVRIGAQLSVLEDLALFPEPQPVENMKLYHSWLLVGSRTEV TQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECVAHAGEHRGLVQDIES ADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQPSGVT ALTPRRDGLEVVVTPGAMGAYACECQEGGAAHVVAAYSLVWGSQRDAPSR AHTVGAGLAGFFLGILAASLTLILIGRRQQRRRQRELLARDKVGLDLGAP PSGTTSYSQDPPSPSPEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHI RLTGAPLATCDETSI
    • Amino acids
      1 to 615
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • M SEMA
    • m Sema M
    • PRO2353
    • SEM4F_HUMAN
    • Sema domain immunoglobulin domain (Ig) transmembrane
    • Sema M
    • Sema W
    • Sema4f
    • SEMAM
    • Semaphorin M
    • Semaphorin W
    • Semaphorin-4F
    • Semaphorin-M
    • Semaphorin-W
    • SEMAW
    see all
  • Function
    Has growth cone collapse activity against retinal ganglion-cell axons.
  • Sequence similarities
    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161030 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161030.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up