Recombinant Human Sema6A protein (ab163586)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQMIMIMNGTLYI AARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
    • Amino acids
      21 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HT018
    • SEM6A_HUMAN
    • SEMA
    • Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A
    • Sema Q
    • Sema VIA
    • Sema6a
    • SEMA6A 1
    • SEMA6A-1
    • SEMA6A1
    • Semaphorin 6A 1
    • Semaphorin Q
    • Semaphorin VIA
    • Semaphorin-6A
    • Semaphorin-6A-1
    • SEMAQ
    • VIA
    see all
  • Function
    Cell surface receptor for PLXNA2 that plays an important role in cell-cell signaling. Required for normal granule cell migration in the developing cerebellum. Promotes reorganization of the actin cytoskeleton and plays an important role in axon guidance in the developing central nervous system. Can act as repulsive axon guidance cue. Has repulsive action towards migrating granular neurons. May play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation.
  • Sequence similarities
    Belongs to the semaphorin family.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab163586 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up