Recombinant Human Semaphorin 3A protein (ab153075)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEF CEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRS
    • Amino acids
      672 to 770
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Coll 1
    • Coll1
    • Collapsin 1
    • HH16
    • Hsema I
    • Hsema III
    • Sema domain immunoglobulin domain (Ig) short basic domain secreted (semaphorin) 3A
    • sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
    • Sema III
    • SEMA1
    • SEMA1-PEN
    • SEMA3A
    • SEMAD
    • SEMAIII
    • SEMAL
    • Semaphorin 3A precursor
    • Semaphorin III
    • semaphorin L
    • Semaphorin like growth cone guidance homolog of chick collapsin
    • Semaphorin-D
    • Semaphorin3A
    • SemD
    see all
  • Relevance
    One family of inhibitory axon guidance molecules is the semaphorins. The semaphorins include secreted, transmembrane, and GPI anchored extracellular molecules that are involved in regulating axon guidance by inhibiting axons from growing toward incorrect targets. Semaphorin 3A (Sema3A) may play a particularly interesting role in limiting axon regeneration since it is expressed in meningeal fibroblasts that invade the injured spinal cord and surround the glial scar. In addition, the Sema3A co receptors, Neuropilin 1 and Plexin A1, are expressed on axons that regenerate up to the injured region, but do not cross this Sema3A containing region. Thus, Sema3A and its co receptors may have important roles in regulating axon guidance during neuronal development and after neuronal injury.
  • Cellular localization
    Secreted

Images

  • ab153075 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up