Recombinant Human Semaphorin 3c protein (ab153780)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGS KDHILSLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQ TFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNP NVNTVSVMINEELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSE PMFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDT GGLRSLVNKWTTFLKARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTL VYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPNHQLISYQGRI PYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLI VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSG ELILEELEVFKNHAPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTA CADCCLARDPYCAWDGHSCSRFYPTGKRRSRRQDVRHGNPLTQCRGFNLK AYRNAAEIVQYGVKNNTTFLECAPKSPQASIKWLLQKDKDRRKEVKLNER IIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKINFKVLDSEMVAVV TDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGD ESQKMRGDYGKLKALINSVDHHHHHH
    • Molecular weight
      82 kDa including tags
    • Amino acids
      21 to 738
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab153780 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from an 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Dissolve the lyophilized protein in 1X PBS.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • Sema E
    • SEMA3C
    • semaE
    • Semahorin3C
    • Semaphorin E
    • SemaphorinE
    see all
  • Relevance
    The Semaphorins constitute a large family of secreted and membrane-tethered cell signaling molecules. They have functions in neural development, immunology, cardiac growth, vascular development, lung morphogenesis and axial bone patterning. Semaphorins are defined by the presence of a conserved Sema domain at the N-terminus. These proteins can be classified into eight classes depending on their structure and species origin. Classes 3 through 7 are found in vertebrates; class 3 are secreted, class 7 are GPI-anchored and class 4 through 6 are transmembrane proteins. Two distinct transmembrane receptor families have been identified as Semaphorin receptors. Neuropilins provide binding specificity for the class 3 Semaphorins, whereas Plexins, which also contain a Sema domain serve as signaling partners for class 3 Semaphorins and as functional receptors for transmembrane Semaphorins. Semaphorin 3c inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. It is expressed maximally between days E10-12 with moderate levels from day E13 until birth.
  • Cellular localization
    Secreted

References

ab153780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up