Recombinant Human Semaphorin 3D protein (ab153631)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYIQILSSP NFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDELPR AVAT
    • Amino acids
      674 to 777
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Coll 2
    • Coll2
    • Collapsin 2
    • SEM3D_HUMAN
    • Sema domain immunoglobulin domain (Ig) short basic domain secreted (semaphorin) 3D
    • Sema Z2
    • Sema3d
    • Semaphorin-3D
    • Semaphorin3D
    see all
  • Function
    Induces the collapse and paralysis of neuronal growth cones. Could potentially act as repulsive cues toward specific neuronal populations. Binds to neuropilin.
  • Sequence similarities
    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Domain
    Strong binding to neuropilin is mediated by the carboxy third of the protein.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab153631 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up