Recombinant Human Semaphorin 4D protein (ab153091)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSY TSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFA DVIRKSPDSP
    • Amino acids
      115 to 224
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A8
    • BB 18
    • BB18
    • CD 100
    • CD100
    • CD100 antigen
    • Coll 4
    • COLL4
    • Collapsin 4
    • Collapsin4
    • GR3
    • Leukocyte activation antigen CD100
    • M sema G
    • MSEMA
    • SEM4D_HUMAN
    • Sema 4d
    • Sema domain immunoglobulin domain Ig transmembrane domain TM and short cytoplasmic domain semaphorin 4D
    • Sema H
    • SEMA J
    • Sema4d
    • Semacl 2
    • Semacl2
    • SemaH
    • SEMAJ
    • Semaphorin 4D
    • Semaphorin C like 2
    • Semaphorin H
    • Semaphorin J
    • Semaphorin-4D
    • Semaphorin4D
    • SemaphorinJ
    • Semcl 2
    • Semcl2
    see all
  • Function
    May play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
  • Tissue specificity
    Strongly expressed in skeletal muscle, peripheral blood lymphocytes, spleen, and thymus and also expressed at lower levels in testes, brain, kidney, small intestine, prostate, heart, placenta, lung and pancreas, but not in colon and liver.
  • Sequence similarities
    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab153091 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up