Recombinant human Semaphorin 4D protein (ab168894)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKDTLYIGAREAVF AVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSAT SLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDG ELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSP DSPDGEDDRVYFFFTEVSVEYEFVFRVLIPRIARVCKGDQGGLRTLQKKW TSFLKARLICSRPDSGLVFNVLRDVFVLRSPGLKVPVFYALFTPQLNNVG LSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNGPVPKPRPGACI DSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNYT QIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFE PVQTLLLSSKKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCA WSPPTATCVALHQTESPSRGLIQEMSGDASVCPDKSKGSYRQHFFKHGGT AELKCSQKSNLARVFWKFQNDVLKAESPKYGLMGRKNLLIFNLSEGDSGV YQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSVVQTEGSRIATK VLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQLH SEKTMYLKSSDNR
    • Molecular weight
      105 kDa
    • Amino acids
      22 to 734

Specifications

Our Abpromise guarantee covers the use of ab168894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to promote the survival and differentiation of Human peripheral blood monocytes. The ED50 for this effect is typically 2.0-6.3 µg/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    pH: 7.00
    Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 250 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • A8
    • BB 18
    • BB18
    • CD 100
    • CD100
    • CD100 antigen
    • Coll 4
    • COLL4
    • Collapsin 4
    • Collapsin4
    • GR3
    • Leukocyte activation antigen CD100
    • M sema G
    • MSEMA
    • SEM4D_HUMAN
    • Sema 4d
    • Sema domain immunoglobulin domain Ig transmembrane domain TM and short cytoplasmic domain semaphorin 4D
    • Sema H
    • SEMA J
    • Sema4d
    • Semacl 2
    • Semacl2
    • SemaH
    • SEMAJ
    • Semaphorin 4D
    • Semaphorin C like 2
    • Semaphorin H
    • Semaphorin J
    • Semaphorin-4D
    • Semaphorin4D
    • SemaphorinJ
    • Semcl 2
    • Semcl2
    see all
  • Function
    May play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
  • Tissue specificity
    Strongly expressed in skeletal muscle, peripheral blood lymphocytes, spleen, and thymus and also expressed at lower levels in testes, brain, kidney, small intestine, prostate, heart, placenta, lung and pancreas, but not in colon and liver.
  • Sequence similarities
    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab168894 stained overnight with Coomassie Blue.

References

ab168894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up