Recombinant Human Semenogelin I protein (ab153783)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDA NDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHF HRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSK EQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNV VEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNL NQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVA GKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGG LDIVIIEQEDDSDRHLAQHLNNDQNPLFTVDHHHHHH
    • Molecular weight
      44 kDa including tags
    • Amino acids
      24 to 402
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab153783 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 4.50
    Constituents: 99% Sodium acetate, 0.88% Sodium chloride

  • Reconstitution
    Lyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • Alpha-Inhibin-31
    • Alpha-Inhibin-92
    • Cancer/testis antigen 103
    • CT103
    • dJ172H20.2
    • dJ172H20.2 (semenogelin I)
    • MGC14719
    • Semen coagulating protein
    • Semenogelin
    • Semenogelin I
    • SEMG
    • SEMG1
    • SEMG1_HUMAN
    • Seminal basic protein
    • seminal vesicle secretory protein 5
    • SgI
    • Svp-1
    • Svp5
    • SVPIIA
    • Svs2
    • SVS2P
    • Svs2p2
    • Svs5
    see all
  • Function
    Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.
    Alpha-inhibin-92 and alpha-inhibin-31, derived from the proteolytic degradation of semenogelin, inhibit the secretion of pituitary follicle-stimulating hormone.
  • Tissue specificity
    Seminal vesicle.
  • Sequence similarities
    Belongs to the semenogelin family.
  • Post-translational
    modifications
    Transglutaminase substrate.
    Rapidly cleaved after ejaculation by KLK3/PSA, resulting in liquefaction of the semen coagulum and the progressive release of motile spermatozoa.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab153783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up