Recombinant human SENP1 protein (Catalytic domain) (ab188689)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLN WLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTK KVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILL QYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCI TKDRPINFTQQHMPYFRKRMVWEILHRKL
    • Molecular weight
      30 kDa including tags
    • Amino acids
      415 to 643
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Catalytic Domain of SENP1.

Specifications

Our Abpromise guarantee covers the use of ab188689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Typical enzyme concentration to support hydrolysis of substrates in vitro is 50- 500 nM depending on conditions. Pre-incubation (15 min) with 10 mM DTT is recommended to achieve maximum activity.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.077% DTT, 1.19% HEPES, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • SENP 1
    • SENP1
    • SENP1_HUMAN
    • Sentrin specific protease 1
    • Sentrin-specific protease 1
    • Sentrin/SUMO specific protease
    • Sentrin/SUMO specific protease 1
    • Sentrin/SUMO specific protease SENP 1
    • Sentrin/SUMO specific protease SENP1
    • Sentrin/SUMO-specific protease SENP1
    • SUMO1/sentrin specific peptidase 1
    • SUMO1/sentrin specific protease 1
    • SuPr 2
    • SuPr2
    see all
  • Function
    Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. Deconjugates SUMO1 from HIPK2. Deconjugates SUMO1 from HDAC1, which decreases its transcriptional repression activity.
  • Tissue specificity
    Highly expressed in testis. Expressed at lower levels in thymus, pancreas, spleen, liver, ovary and small intestine.
  • Sequence similarities
    Belongs to the peptidase C48 family.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles between cytoplasm and nucleus.
  • Information by UniProt

References

ab188689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up