Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWN RQLRHFQGRKKALQIQKTWIKDEHLCAKTKFNVATQNVSTLSSKVKRKDA KHFISSSK
    • Amino acids
      2 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FKSG45
    • FLJ42398
    • MGC27076
    • Protease FKSG45
    • SENP5
    • SENP5_HUMAN
    • Sentrin specific protease SENP5
    • Sentrin-specific protease 5
    • Sentrin/SUMO specific protease SENP5
    • Sentrin/SUMO-specific protease SENP5
    • SUMO specific protease SENP5
    • SUMO1/sentrin specific peptidase 5
    • SUMO1/sentrin specific protease 5
    see all
  • Function
    Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO3 to its mature form and deconjugation of SUMO2 and SUMO3 from targeted proteins. Has weak proteolytic activity against full-length SUMO1 or SUMO1 conjugates. Required for cell division.
  • Sequence similarities
    Belongs to the peptidase C48 family.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab165910 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up