Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ99719
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMSTGLRYKSKLATPEDKQDIDKQYVGF ATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLS AEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKPITD YVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKA LHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSDE DEDFKQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAH CDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMES PIPILPLPTPDAETEKLIRMKDEELRRMQEMLQRMKQQMQDQ
    • Molecular weight45 kDa including tags
    • Amino acids1 to 369
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109972 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.3M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 5 Sep
    • CDCREL
    • CDCrel 1
    • CDCrel-1
    • CDCREL1
    • Cell division control related protein 1
    • Cell division control-related protein 1
    • H5
    • HCDCREL 1
    • OTTHUMP00000197271
    • OTTHUMP00000197272
    • OTTHUMP00000197273
    • OTTHUMP00000197274
    • OTTHUMP00000197275
    • OTTHUMP00000197276
    • OTTHUMP00000197396
    • OTTHUMP00000197410
    • Peanut like 1
    • Peanut like 1 homolog
    • Peanut like protein 1
    • Peanut-like protein 1
    • Platelet glycoprotein Ib beta chain
    • PNUTL1
    • SEPT5
    • SEPT5_HUMAN
    • Septin 5
    • Septin-5
    see all
  • FunctionFilament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential). May play a role in platelet secretion.
  • Tissue specificityExpressed at high levels in the CNS, as well as in heart and platelets (at protein level).
  • Sequence similaritiesBelongs to the septin family.
  • Post-translational
    modifications
    In platelets, phosphorylated in response to thrombin, phorbol-12-myristate-13-acetate and collagen.
  • Cellular localizationCytoplasm. Cytoplasm > cytoskeleton. In platelets, found in areas surrounding alpha-granules.
  • Information by UniProt

Recombinant Human SEPT5 protein images

  • 15% SDS-PAGE analysis of 3 µg ab109972.

References for Recombinant Human SEPT5 protein (ab109972)

ab109972 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"