Overview

  • Product nameRecombinant Human SEPT6 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ14141
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMAATDIARQVGEGCRTVPLAGHVGFDS LPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPATHTQP GVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFE AYLQEELKIRRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKV NIIPIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEING TMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREM LIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAK RNEFLGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQD EKKKLEDKKKSLDDEVNAFKQRKTAAELPQSQGSQAGGSQTLKRDKEKKN NPWLCTE
    • Molecular weight52 kDa including tags
    • Amino acids1 to 434
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab113123 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • KIAA0128
    • Nkrf
    • RCG53214, isoform CRA_d
    • RP5-876A24.2
    • SEP2
    • SEPT2
    • SEPT6
    • SEPT6/MLL FUSION GENE
    • SEPT6_HUMAN
    • Septin 2
    • Septin 6
    • Septin-6
    see all
  • FunctionFilament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Involved in cytokinesis. May play a role in HCV RNA replication.
  • Tissue specificityWidely expressed.
  • Sequence similaritiesBelongs to the septin family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm. Cytoplasm > cytoskeleton > spindle. Chromosome > centromere > kinetochore. Cleavage furrow. Midbody. In metaphase cells, localized within the microtubule spindle. At the metaphase plate, in close apposition to the kinetochores of the congressed chromosomes. In cells undergoing cytokinesis, localized to the midbody, the ingressing cleavage furrow, and the central spindle.
  • Information by UniProt

Recombinant Human SEPT6 protein images

  • 15% SDS-PAGE analysis of ab113123 (3 µg)

References for Recombinant Human SEPT6 protein (ab113123)

ab113123 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"