Recombinant Human Septin 2 protein (ab99296)

Overview

  • Product name
    Recombinant Human Septin 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSKQQPTQFINPETPGYVGFANLPNQVHRK SVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVISGAAEKIERTVQ IEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYL HDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPV IAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRL LKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELR RMQEMIARMQAQMQMQMQGGDGDGGALGHHV
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 361
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99296 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • DIFF6
    • hNEDD5
    • KIAA0158
    • NEDD 5
    • NEDD5
    • Neural precursor cell expressed developmentally down regulated 5
    • Neural precursor cell expressed developmentally down regulated protein 5
    • Pnutl3
    • Protein NEDD5
    • SEPT2
    • septin 2
    see all
  • Relevance
    The septins are a family of cytoskeletal GTPases that play an essential role in cytokinesis in mammalian cells. Septin 2 (Nedd5) is a mammalian septin known to associate with actin based structures such as the contractile ring and stress fibers. It is involved in cytokinesis and may assemble into a multicomponent structure.
  • Cellular localization
    Cytoplasm. Cytoplasm; cytoskeleton. Cytoplasm; cytoskeleton; spindle. Chromosome; centromere; kinetochore. Cleavage furrow. Midbody. Cytoplasm; cell cortex. Cell projection; cilium membrane.

Recombinant Human Septin 2 protein images

  • 15% SDS-PAGE showing ab99296 (3µg).

References for Recombinant Human Septin 2 protein (ab99296)

ab99296 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up