Recombinant Human Septin 2 protein (ab99296)

Overview

  • Product name
    Recombinant Human Septin 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSKQQPTQFINPETPGYVGFANLPNQVHRK SVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVISGAAEKIERTVQ IEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYL HDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPV IAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRL LKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELR RMQEMIARMQAQMQMQMQGGDGDGGALGHHV
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 361
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99296 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • DIFF6
    • hNEDD5
    • KIAA0158
    • NEDD 5
    • NEDD5
    • Neural precursor cell expressed developmentally down regulated 5
    • Neural precursor cell expressed developmentally down regulated protein 5
    • Pnutl3
    • Protein NEDD5
    • SEPT2
    • septin 2
    see all
  • Relevance
    The septins are a family of cytoskeletal GTPases that play an essential role in cytokinesis in mammalian cells. Septin 2 (Nedd5) is a mammalian septin known to associate with actin based structures such as the contractile ring and stress fibers. It is involved in cytokinesis and may assemble into a multicomponent structure.
  • Cellular localization
    Cytoplasm. Cytoplasm; cytoskeleton. Cytoplasm; cytoskeleton; spindle. Chromosome; centromere; kinetochore. Cleavage furrow. Midbody. Cytoplasm; cell cortex. Cell projection; cilium membrane.

Images

  • 15% SDS-PAGE showing ab99296 (3µg).

References

ab99296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up