Recombinant Human Septin 8 protein (ab161559)

Overview

  • Product name
    Recombinant Human Septin 8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDD EAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHC DFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFS LQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFE HLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPL RKDKDKKN
    • Amino acids
      1 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0202
    • OTTHUMP00000211755
    • SEP 2
    • SEP2
    • SEPT 8
    • SEPT8
    • Septin8
    see all
  • Relevance
    Septin 8 (SEPT8) is a member of the highly conserved septin family. Septins are 40- to 60-kD GTPases that assemble as filamentous scaffolds. They are involved in the organization of submembranous structures, in neuronal polarity, and in vesicle trafficking. There are 3 isoforms produced by alternative splicing.
  • Cellular localization
    Cytoplasmic; cytoskeleton.

Images

  • ab161559 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up