Recombinant Human SERCA3 ATPase protein (ab116848)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIR DWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGML DPPRPEVAACITRCYQAGIR
    • Molecular weight
      39 kDa including tags
    • Amino acids
      501 to 620

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenosine triphosphatase calcium
    • AT2A3_HUMAN
    • Atp2a3
    • ATPase Ca(2+) transporting ubiquitous
    • ATPase Ca++ transporting ubiquitous
    • Calcium pump 3
    • Calcium translocating P type ATPase
    • Sarco/endoplasmic reticulum Ca2+ ATPase
    • Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
    • SERCA 3
    • SERCA3
    • SERCA3b
    • SR Ca(2+) ATPase 3
    • SR Ca(2+)-ATPase 3
    see all
  • Function
    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.
  • Tissue specificity
    Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues.
  • Sequence similarities
    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily.
  • Cellular localization
    Nucleus membrane. Endoplasmic reticulum membrane. Sarcoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116848 at approximately 38.83 kDa.

References

ab116848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up