Recombinant Human SERCA3 ATPase protein (ab116848)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIR DWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGML DPPRPEVAACITRCYQAGIR
    • Molecular weight
      39 kDa including tags
    • Amino acids
      501 to 620

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenosine triphosphatase calcium
    • AT2A3_HUMAN
    • Atp2a3
    • ATPase Ca(2+) transporting ubiquitous
    • ATPase Ca++ transporting ubiquitous
    • Calcium pump 3
    • Calcium translocating P type ATPase
    • Sarco/endoplasmic reticulum Ca2+ ATPase
    • Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
    • SERCA 3
    • SERCA3
    • SERCA3b
    • SR Ca(2+) ATPase 3
    • SR Ca(2+)-ATPase 3
    see all
  • Function
    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.
  • Tissue specificity
    Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues.
  • Sequence similarities
    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily.
  • Cellular localization
    Nucleus membrane. Endoplasmic reticulum membrane. Sarcoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human SERCA3 ATPase protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116848 at approximately 38.83 kDa.

References for Recombinant Human SERCA3 ATPase protein (ab116848)

ab116848 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up