Recombinant Human Serglycin protein (ab116976)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP10124
    • SpeciesHuman
    • SequenceMMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRCNPDSNSANCL EEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGS GSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQH GLEEDFML
    • Molecular weight43 kDa including tags
    • Amino acids1 to 158

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chondroitin sulfate proteoglycan core protein
    • Cytolytic granule proteoglycan core protein
    • FLJ12930
    • gp600
    • Hematopoetic proteoglycan core protein
    • Mastocytoma proteoglycan core protein
    • MGC9289
    • OTTHUMP00000019716
    • P.PG
    • PG19 core protein
    • Pgsg
    • Platelet proteoglycan core protein
    • platelet proteoglycan protein core
    • PLATELET PROTEOGLYCAN PROTEIN CORE; PPG
    • PPG
    • PRG
    • PRG1
    • PROTEOGLYCAN 1
    • proteoglycan 1, secretory granule
    • Proteoglycan 10K core protein
    • Proteoglycan peptide core protein
    • PROTEOGLYCAN PROTEIN CORE FOR MAST CELL SECRETORY GRANULE
    • secretory granule proteoglycan 1
    • Secretory granule proteoglycan core peptide
    • Secretory granule proteoglycan core protein
    • Serglycin
    • serglycin proteoglycan
    • Sgc
    • Srgn
    • SRGN_HUMAN
    see all
  • FunctionPlays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization.
  • Sequence similaritiesBelongs to the serglycin family.
  • Post-translational
    modifications
    O-glcosylated; contains chondroitin sulfate and heparan sulfate.
  • Cellular localizationCytoplasmic granule. Secreted > extracellular space. Golgi apparatus. Found in mast cell granules and in cytoplasmic granules of cytolytic T lymphocytes from where it is secreted upon cell activation. Secreted constitutively by endothelial cells and macrophages. Located to Golgi apparatus during neutrophil differentiation.
  • Information by UniProt

Recombinant Human Serglycin protein images

  • 12.5% SDS-PAGE showing ab116976 at approximately 43.49kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Serglycin protein (ab116976)

ab116976 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"