Recombinant Human Serine racemase protein (ab116196)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMCAQYCISFADVEKAHINIRDSIHLT PVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKP KAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIV YCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPL VDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKL MPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWE RMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWV KQAERPASYQSVSV
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 340
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab116196 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • D serine ammonia lyase
    • D serine dehydratase
    • D-serine ammonia-lyase
    • D-serine dehydratase
    • ILV1
    • ISO1
    • L serine ammonia lyase
    • L serine dehydratase
    • L-serine ammonia-lyase
    • L-serine dehydratase
    • Serine racemase
    • srr
    • SRR_HUMAN
    see all
  • Function
    Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine.
  • Tissue specificity
    Brain: expressed at high levels in hippocampus and corpus callosum, intermediate levels in substantia nigra and caudate, and low levels in amygdala, thalamus, and subthalamic nuclei. Expressed in heart, skeletal muscle, kidney and liver.
  • Sequence similarities
    Belongs to the serine/threonine dehydratase family.
  • Post-translational
    modifications
    S-nitrosylated, leading to decrease the enzyme activity.
  • Information by UniProt

Recombinant Human Serine racemase protein images

  • 15% SDS-PAGE analysis of 3 µg ab116196.

References for Recombinant Human Serine racemase protein (ab116196)

ab116196 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. Activity has not been assayed. Please do not hesitate to contact us if you need any more advice or information.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up