Recombinant human Serine/threonine-protein kinase 4 (ab196075)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ETVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKE TGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIV MEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIK AGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGY NCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWS DNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDVK LKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGA NTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQ KEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLAL DPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF
    • Molecular weight
      82 kDa including tags
    • Amino acids
      2 to 487
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      NM_006282.

Specifications

Our Abpromise guarantee covers the use of ab196075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 73 pmole/min/µg.

     

    Enzyme reaction is conducted in a buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl2, 1 mM EGTA, 200 µM ATP, 0.01% Brij-35 and 2 µM substrate at 30°C for 1 hour.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >= 50 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 0.55% Glutathione, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Kinase responsive to stress
    • Krs2
    • Mammalian STE20 like protein kinase 1
    • Mammalian STE20-like protein kinase 1
    • Mammalian sterile 20 like 1
    • MST-1
    • MST1
    • Serine/threonine kinase 4
    • Serine/threonine protein kinase Krs 2
    • Serine/threonine-protein kinase 4
    • Serine/threonine-protein kinase Krs-2
    • STE20 like kinase MST1
    • STE20-like kinase MST1
    • STK4
    • STK4_HUMAN
    • TIIAC
    • YSK3
    see all
  • Function
    Stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation. Key component of the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. MST1/MST2 are required to repress proliferation of mature hepatocytes, to prevent activation of facultative adult liver stem cells (oval cells), and to inhibit tumor formation (By similarity). Phosphorylates 'Ser-14' of histone H2B (H2BS14ph) during apoptosis. Phosphorylates FOXO3 upon oxidative stress, which results in its nuclear translocation and cell death initiation.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SARAH domain.
  • Post-translational
    modifications
    Autophosphorylated on serine and threonine residues.
  • Cellular localization
    Cytoplasm. Nucleus. The caspase-cleaved form cycles between the nucleus and cytoplasm.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of 6 µg ab196075 with Coomassie staining.

  • Activity assay using ab196075.

References

ab196075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up