Recombinant Human SERPINB1 protein (ab114774)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP30740
    • SpeciesHuman
    • SequenceMEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNT AAQLSKTFHFNTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNF LPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLAS GMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQ KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQL TLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS KADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE NFTADHPFLFFIRHNSSGSILFLGRFSSP
    • Molecular weight67 kDa including tags
    • Amino acids1 to 379

Specifications

Our Abpromise guarantee covers the use of ab114774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anti elastase
    • EI
    • ELANH2
    • Epididymis luminal protein 57
    • HEL57
    • ILEU_HUMAN
    • LEI
    • Leukocyte elastase inhibitor
    • M/NEI
    • MNEI
    • Monocyte/neutrophil elastase inhibitor
    • Peptidase inhibitor 2
    • Pi-2
    • PI2
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 1
    • Serpin B1
    • Serpin peptidase inhibitor clade B (ovalbumin) member 1
    • serpinb1
    see all
  • FunctionRegulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.
  • Sequence similaritiesBelongs to the serpin family. Ov-serpin subfamily.
  • DomainReactive bond 1 is specific for reaction with chymotrypsin-like protease such as cathepsin G, chymotrypsin or chymase, while reactive bond 2 is specific for reaction with elastase-like protease such as neutrophyl elastase, proteinase-3, pancreatic elastase or PSA.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SERPINB1 protein images

  • ab114774 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human SERPINB1 protein (ab114774)

ab114774 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"