Recombinant Human SERPINB1 protein (ab114775)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQL TLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      201 to 300

Specifications

Our Abpromise guarantee covers the use of ab114775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anti elastase
    • EI
    • ELANH2
    • Epididymis luminal protein 57
    • HEL57
    • ILEU_HUMAN
    • LEI
    • Leukocyte elastase inhibitor
    • M/NEI
    • MNEI
    • Monocyte/neutrophil elastase inhibitor
    • Peptidase inhibitor 2
    • Pi-2
    • PI2
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 1
    • Serpin B1
    • Serpin peptidase inhibitor clade B (ovalbumin) member 1
    • serpinb1
    see all
  • Function
    Regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.
  • Sequence similarities
    Belongs to the serpin family. Ov-serpin subfamily.
  • Domain
    Reactive bond 1 is specific for reaction with chymotrypsin-like protease such as cathepsin G, chymotrypsin or chymase, while reactive bond 2 is specific for reaction with elastase-like protease such as neutrophyl elastase, proteinase-3, pancreatic elastase or PSA.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab114775 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114775 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up