Recombinant Human SerpinB2 protein (ab187422)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMEDLCVANTLFALNLFKHLAKASPTQN LFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTPMTPENFT SCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVN KLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQT KGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSA QRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVST GLELLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSM GMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNEEGTEAAAGTGGVM TGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 415
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_001137290

Specifications

Our Abpromise guarantee covers the use of ab187422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    ab187422 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 30% Glycerol, 0.02% DTT, 69% PBS

General Info

  • Alternative names
    • HsT1201
    • Monocyte Arg serpin
    • Monocyte Arg-serpin
    • Monocyte Arginine-serpin
    • Monocyte-derived plasminogen activator inhibitor
    • PAI
    • PAI-2
    • PAI2
    • PAI2_HUMAN
    • Placental plasminogen activator inhibitor
    • PLANH2
    • Plasminogen activator inhibitor 2
    • plasminogen activator inhibitor, type 2
    • plasminogen activator inhibitor, type II (arginine-serpin)
    • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 2
    • Serpin B2
    • serpin peptidase inhibitor, clade B (ovalbumin), member 2
    • Serpinb2
    • Urokinase inhibitor
    see all
  • Function
    Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
  • Sequence similarities
    Belongs to the serpin family. Ov-serpin subfamily.
  • Post-translational
    modifications
    The signal sequence is not cleaved.
  • Cellular localization
    Cytoplasm. Secreted > extracellular space.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab187422 (3 μg).

References

ab187422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up