Recombinant Human SerpinB3 protein (ab114532)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVL SGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQ NKTNSILFYGRFSSP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      276 to 390

Specifications

Our Abpromise guarantee covers the use of ab114532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • HsT1196
    • Protein T4 A
    • Protein T4-A
    • SCC
    • SCCA
    • SCCA PD
    • SCCA-1
    • SCCA-PD
    • SCCA1
    • SCCAPD
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 3
    • Serpin B3
    • Serpin peptidase inhibitor clade B (ovalbumin) member 3
    • serpin peptidase inhibitor, clade B (ovalbumin), member 3
    • SERPINB3
    • SPB3_HUMAN
    • Squamous cell carcinoma antigen 1
    • T4 A
    • T4-A
    • T4A
    see all
  • Function
    May act as a protease inhibitor to modulate the host immune response against tumor cells.
  • Tissue specificity
    Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
  • Sequence similarities
    Belongs to the serpin family. Ov-serpin subfamily.
  • Developmental stage
    Its expression is closely related to cellular differentiation in both normal and malignant squamous cells.
  • Cellular localization
    Cytoplasm. Seems to also be secreted in plasma by cancerous cells but at a low level.
  • Information by UniProt

Recombinant Human SerpinB3 protein images

  • 12.5% SDS-PAGE analysis of Human SerpinB3 protein (ab114532). Stained with Coomassie Blue.

References for Recombinant Human SerpinB3 protein (ab114532)

ab114532 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up