Recombinant Human SerpinB3 protein (ab114532)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVL SGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQ NKTNSILFYGRFSSP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      276 to 390

Specifications

Our Abpromise guarantee covers the use of ab114532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • HsT1196
    • Protein T4 A
    • Protein T4-A
    • SCC
    • SCCA
    • SCCA PD
    • SCCA-1
    • SCCA-PD
    • SCCA1
    • SCCAPD
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 3
    • Serpin B3
    • Serpin peptidase inhibitor clade B (ovalbumin) member 3
    • serpin peptidase inhibitor, clade B (ovalbumin), member 3
    • SERPINB3
    • SPB3_HUMAN
    • Squamous cell carcinoma antigen 1
    • T4 A
    • T4-A
    • T4A
    see all
  • Function
    May act as a protease inhibitor to modulate the host immune response against tumor cells.
  • Tissue specificity
    Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
  • Sequence similarities
    Belongs to the serpin family. Ov-serpin subfamily.
  • Developmental stage
    Its expression is closely related to cellular differentiation in both normal and malignant squamous cells.
  • Cellular localization
    Cytoplasm. Seems to also be secreted in plasma by cancerous cells but at a low level.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of Human SerpinB3 protein (ab114532). Stained with Coomassie Blue.

References

ab114532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up