Recombinant Human SerpinB7 protein (ab160155)

Overview

  • Product name
    Recombinant Human SerpinB7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFF PQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSY I
    • Amino acids
      227 to 327
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Megsin
    • Mesangium predominant gene megsin
    • MGC120014
    • MGC120015
    • Serpin B7
    • Serpin peptidase inhibitor clade B (ovalbumin) member 7
    • Serpinb7
    • SPB7_HUMAN
    • TP55
    see all
  • Function
    Might function as an inhibitor of Lys-specific proteases. Might influence the maturation of megakaryocytes via its action as a serpin.
  • Tissue specificity
    Predominantly expressed in mesangial cells.
  • Sequence similarities
    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab160155 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up