Recombinant Human SerpinB8 protein (ab116853)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP50452
    • SpeciesHuman
    • SequenceMDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGST AAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDF LPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDA GTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKE AKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE
    • Molecular weight53 kDa including tags
    • Amino acids1 to 242

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAP 2
    • CAP-2
    • CAP2
    • Cytoplasmic antiproteinase 2
    • OTTHUMP00000067000
    • OTTHUMP00000067001
    • Peptidase inhibitor 8
    • PI 8
    • PI-8
    • PI8
    • Protease inhibitor 8 (ovalbumin type)
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 8
    • Serpin B8
    • Serpin peptidase inhibitor clade B (ovalbumin) member 8
    • Serpinb8
    • SPB8_HUMAN
    see all
  • Sequence similaritiesBelongs to the serpin family. Ov-serpin subfamily.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SerpinB8 protein images

  • 12.5% SDS-PAGE showing ab116853 at approximately 52.73kDa and stained with Coomassie Blue.

References for Recombinant Human SerpinB8 protein (ab116853)

ab116853 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"