Recombinant Human SerpinB8 protein (ab116853)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGST AAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDF LPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDA GTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKE AKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE
    • Molecular weight
      53 kDa including tags
    • Amino acids
      1 to 242

Specifications

Our Abpromise guarantee covers the use of ab116853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CAP 2
    • CAP-2
    • CAP2
    • Cytoplasmic antiproteinase 2
    • OTTHUMP00000067000
    • OTTHUMP00000067001
    • Peptidase inhibitor 8
    • PI 8
    • PI-8
    • PI8
    • Protease inhibitor 8 (ovalbumin type)
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 8
    • Serpin B8
    • Serpin peptidase inhibitor clade B (ovalbumin) member 8
    • Serpinb8
    • SPB8_HUMAN
    see all
  • Sequence similarities
    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116853 at approximately 52.73kDa and stained with Coomassie Blue.

References

ab116853 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up