Recombinant Human SERPINI2 protein (ab182804)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFCSAMKNTEFAVDLYQEVSLSH KDNIIFSPLGITLVLEMVQLGAKGKAQQQIRQTLKQQETSAGEEFFVLKS FFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNKEFFQSAIKLVDFQ DAKACAEMISTWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQ KFRKEDTQLINFTKKNGSTVKIPMMKALLRTKYGYFSESSLNYQVLELSY KGDEFSLIIILPAEGMDIEEVEKLITAQQILKWLSEMQEEEVEISLPRFK VEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFFEINE DGSEAATSTGIHIPVIMSLAQSQFIANHPFLFIMKHNPTESILFMGRVTN PDTQEIKGRDLDSL
    • Molecular weight
      47 kDa including tags
    • Amino acids
      21 to 405
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      Mature protein; constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_006208.

Specifications

Our Abpromise guarantee covers the use of ab182804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab182804 is expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • MEPI
    • Myoepithelium derived serine protease inhibitor
    • Myoepithelium-derived serine protease inhibitor
    • Pancpin
    • Pancreas specific protein TSA2004
    • Pancreas-specific protein TSA2004
    • Peptidase inhibitor 14
    • PI 14
    • PI-14
    • PI14
    • Protease inhibitor 14
    • Serine (or cysteine) proteinase inhibitor clade I (neuroserpin) member 2
    • Serine (or cysteine) proteinase inhibitor clade I (pancpin) member 2
    • Serpin I2
    • Serpin peptidase inhibitor clade I (pancpin) member 2
    • Serpini2
    • SPI2_HUMAN
    • TSA2004
    see all
  • Tissue specificity
    Expressed in pancreas and adipose tissues.
  • Sequence similarities
    Belongs to the serpin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab182804 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up