Recombinant Human Serum Amyloid A protein (ab88459)

Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGS DKYFHAR GNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQ AANEWGRSGKDPNHFR PAGLPEKY

Specifications

Our Abpromise guarantee covers the use of ab88459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88459 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Amyloid fibril protein AA
    • Amyloid fibrils
    • Amyloid protein A
    • Fibrils
    • MGC111216
    • OC
    • PIG 4
    • PIG4
    • SAA
    • SAA 1
    • SAA 2
    • SAA_HUMAN
    • SAA1
    • SAA2
    • Serum amyloid A protein precursor
    • Serum amyloid A1 isoform 1
    • Serum amyloid A1 isoform 2
    • Serum amyloid protein A(4-101)
    • TP53I4
    • Tumor protein p53 inducible protein 4
    see all
  • FunctionMajor acute phase reactant. Apolipoprotein of the HDL complex.
  • Tissue specificityExpressed by the liver; secreted in plasma.
  • Involvement in diseaseNote=Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.
    Note=Elevated serum SSA protein levels may be associated with lung cancer.
  • Sequence similaritiesBelongs to the SAA family.
  • Post-translational
    modifications
    This protein is the precursor of amyloid protein A, which is formed by the removal of approximately 24 residues from the C-terminal end.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Human Serum Amyloid A protein (ab88459)

ab88459 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"