Recombinant Human Serum Amyloid P protein (ab151645)

Overview

Description

  • Nature
    Recombinant
  • Source
    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLF SYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWES SSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSF VGEIGDLYMWDSVLPPENILSAYQGTPLPA NILDWQALNYEIRGYVIIKPLVWVDHHHHHH
    • Molecular weight
      23 kDa
    • Amino acids
      20 to 223
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes
    ab151645 was produced by transfected Human cells.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.

General Info

  • Alternative names
    • 9.5S alpha 1 glycoprotein
    • 9.5S alpha-1-glycoprotein
    • Amyloid P component serum
    • APCS
    • MGC88159
    • Pentaxin related
    • Pentraxin 2
    • PTX 2
    • PTX2
    • SAMP_HUMAN
    • SAP
    • Serum amyloid P component
    • Serum amyloid P-component(1-203)
    see all
  • Function
    Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. May also function as a calcium-dependent lectin.
  • Tissue specificity
    Found in serum and urine.
  • Involvement in disease
    Note=SAP is a precursor of amyloid component P which is found in basement membrane and associated with amyloid deposits.
  • Sequence similarities
    Belongs to the pentaxin family.
    Contains 1 pentaxin domain.
  • Post-translational
    modifications
    N-glycosylated with a complex biantennary oligosaccharide chain with a sialic acid at the end (disialo-SAP). Monosialo-SAP as well as asioalo-SAP are also detected (PubMed:15174148).
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151645 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up