Recombinant Human Serum Response Factor SRF protein (ab114319)

Overview

  • Product nameRecombinant Human Serum Response Factor SRF protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP11831
    • SpeciesHuman
    • SequenceHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVP QVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHST KSE
    • Molecular weight37 kDa including tags
    • Amino acids406 to 508

Specifications

Our Abpromise guarantee covers the use of ab114319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • c fos serum response element binding factor
    • c fos serum response element binding transcription factor
    • ELK3
    • ERP
    • MCM 1
    • MCM1
    • OTTHUMP00000039820
    • SAP2
    • Serum response factor
    • SRF
    • SRF serum response factor c fos serum response element binding transcription factor
    • SRF_HUMAN
    see all
  • FunctionSRF is a transcription factor that binds to the serum response element (SRE), a short sequence of dyad symmetry located 300 bp to the 5' of the site of transcription initiation of some genes (such as FOS). Required for cardiac differentiation and maturation.
  • Sequence similaritiesContains 1 MADS-box domain.
  • Post-translational
    modifications
    Phosphorylated by PRKDC.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Serum Response Factor SRF protein images

  • SDS-PAGE analysis of ab114319 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Serum Response Factor SRF protein (ab114319)

ab114319 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"