Recombinant Human Seryl-tRNA synthetase protein (ab116885)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49591
    • SpeciesHuman
    • SequenceMVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRA DNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKV SQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDED VDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVL VFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKV IGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEE FYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTD YQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGI TVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDV TLENRLQNMEVTDA
    • Molecular weight83 kDa including tags
    • Amino acids1 to 515

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C78314
    • cytoplasmic
    • EC 6.1.1.11
    • FLJ36399
    • sarS
    • Sars1
    • Serine tRNA ligase
    • Serine tRNA ligase 1, cytoplasmic
    • Serine--tRNA ligase
    • serine--tRNA ligase, cytoplasmic
    • SerRS
    • SERS
    • Seryl tRNA Ser/Sec synthetase
    • Seryl tRNA synthetase
    • Seryl tRNA synthetase cytoplasmic
    • Seryl-tRNA Ser/Sec synthetase
    • Seryl-tRNA synthetase
    • seryl-tRNA synthetase, cytoplasmic
    • Seryl-tRNA(Ser/Sec) synthetase
    • Strs
    • SYSC_HUMAN
    see all
  • FunctionCatalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).
  • PathwayAminoacyl-tRNA biosynthesis; selenocysteinyl-tRNA(Sec) biosynthesis; L-seryl-tRNA(Sec) from L-serine and tRNA(Sec): step 1/1.
  • Sequence similaritiesBelongs to the class-II aminoacyl-tRNA synthetase family. Type-1 seryl-tRNA synthetase subfamily.
  • DomainConsists of two distinct domains, a catalytic core and a N-terminal extension that is involved in tRNA binding.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Seryl-tRNA synthetase protein images

  • 12.5% SDS-PAGE showing ab116885 at approximately 82.65kDa, stained with Coomassie Blue.

References for Recombinant Human Seryl-tRNA synthetase protein (ab116885)

ab116885 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"