Recombinant Human Seryl-tRNA synthetase protein (ab116885)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRA DNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKV SQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDED VDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVL VFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKV IGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEE FYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTD YQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGI TVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDV TLENRLQNMEVTDA
    • Molecular weight
      83 kDa including tags
    • Amino acids
      1 to 515

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C78314
    • cytoplasmic
    • EC 6.1.1.11
    • FLJ36399
    • sarS
    • Sars1
    • Serine tRNA ligase
    • Serine tRNA ligase 1, cytoplasmic
    • Serine--tRNA ligase
    • serine--tRNA ligase, cytoplasmic
    • SerRS
    • SERS
    • Seryl tRNA Ser/Sec synthetase
    • Seryl tRNA synthetase
    • Seryl tRNA synthetase cytoplasmic
    • Seryl-tRNA Ser/Sec synthetase
    • Seryl-tRNA synthetase
    • seryl-tRNA synthetase, cytoplasmic
    • Seryl-tRNA(Ser/Sec) synthetase
    • Strs
    • SYSC_HUMAN
    see all
  • Function
    Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).
  • Pathway
    Aminoacyl-tRNA biosynthesis; selenocysteinyl-tRNA(Sec) biosynthesis; L-seryl-tRNA(Sec) from L-serine and tRNA(Sec): step 1/1.
  • Sequence similarities
    Belongs to the class-II aminoacyl-tRNA synthetase family. Type-1 seryl-tRNA synthetase subfamily.
  • Domain
    Consists of two distinct domains, a catalytic core and a N-terminal extension that is involved in tRNA binding.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116885 at approximately 82.65kDa, stained with Coomassie Blue.

References

ab116885 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up