Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSA ENVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASRFEIEKRESMFV
    • Amino acids
      271 to 370
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110002G11Rik
    • AU044290
    • MGC118148
    • MGC138241
    • MGC142129
    • OTTMUSP00000022799
    • p53 activated gene 26
    • p53 regulated PA26 nuclear protein
    • p53 regulated protein PA26
    • p53-regulated protein PA26
    • PA26
    • RP11-787I22.1
    • sesn1
    • SESN1_HUMAN
    • SEST1
    • sestrin 1
    • Sestrin-1
    see all
  • Function
    Involved in the reduction of peroxiredoxins. May also be regulator of cellular growth.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the sestrin family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153292 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up