Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ01105
    • SpeciesHuman
    • SequenceMSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQAS EEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEED EEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGD PSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAG ADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDE EGDEDEGEEDEDDDEGEEGEEDEGEDD
    • Molecular weight56 kDa including tags
    • Amino acids1 to 277

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2PP2A
    • HLA DR associated protein II
    • HLA-DR-associated protein II
    • I 2PP2A
    • I-2PP2A
    • I2PP2A
    • IGAAD
    • Inhibitor of granzyme A activated DNase
    • Inhibitor of granzyme A-activated DNase
    • Inhibitor of GzmA-activated DNase
    • inhibitor-2 of protein phosphatase-2A
    • IPP2A2
    • PHAPII
    • Phosphatase 2A inhibitor I2PP2A
    • protein phosphatase type 2A inhibitor
    • Protein SET
    • Set
    • SET nuclear oncogene
    • SET translocation
    • SET translocation (myeloid leukemia-associated)
    • SET_HUMAN
    • TAF I
    • TAF IBETA
    • TAF-I
    • TAFI
    • Template activating factor I
    • Template-activating factor I
    • Template-Activating Factor-I, chromatin remodelling factor
    see all
  • FunctionMultitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher.
  • Tissue specificityWidely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms' tumor.
  • Involvement in diseaseNote=A chromosomal aberration involving SET is found in some cases of acute undifferentiated leukemia (AUL). Translocation t(6;9)(q21;q34.1) with NUP214/CAN.
  • Sequence similaritiesBelongs to the nucleosome assembly protein (NAP) family.
  • DomainThe C-terminal acidic domain mediates the inhibition of histone acetyltransferases and is required for the DNA replication stimulatory activity.
  • Post-translational
    modifications
    Isoform 2 is phosphorylated on Ser-15 and Thr-23.
    Isoform 2 is acetylated on Lys-11.
    Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group.
    N-terminus of isoform 1 is methylated by METTL11A/NTM1. Mainly trimethylated.
  • Cellular localizationCytoplasm > cytosol. Endoplasmic reticulum. Nucleus > nucleoplasm. In the cytoplasm, found both in the cytosol and associated with the endoplasmic reticulum. Following CTL attack, moves rapidly to the nucleus, where it is found in the nucleoplasm, avoiding the nucleolus. Similar translocation to the nucleus is also observed for lymphocyte-activated killer cells after the addition of calcium. The SET complex is associated with the endoplasmic reticulum.
  • Information by UniProt

Recombinant Human SET protein images

  • 12.5% SDS-PAGE showing ab114479 at approximately 55.88kDa stained with Coomassie Blue.

References for Recombinant Human SET protein (ab114479)

ab114479 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"