Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGK FFFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDT DGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPD ERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSC ISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRI THQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT PNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAP EWYQVELKAFQATQQK
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 366
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The specific activity of ab167960 was determined to be 40 nmol/min/mg as per activity assay protocol.
  • Applications

    SDS-PAGE

    Western blot

    Functional Studies

  • Purity
    >95% by SDS-PAGE .
    Assessed by densitometry.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • FLJ21193
    • H3 K4 HMTase
    • H3-K4-HMTase SETD7
    • H4 lysine 4 specific
    • Histone H3 K4 methyltransferase
    • Histone H3 lysine 4 specific methyltransferase
    • Histone H3-K4 methyltransferase SETD7
    • Histone H4 K4 methyltransferase
    • Histone lysine N methyltransferase
    • Histone lysine N methyltransferase H3 lysine 4 specific SET7
    • Histone-lysine N-methyltransferase SETD7
    • KIAA1717
    • KMT7
    • Lysine methyltransferase
    • Lysine N-methyltransferase 7
    • OTTHUMP00000164543
    • OTTHUMP00000220049
    • SET 7
    • SET 7/9
    • SET 9
    • SET D7
    • SET domain containing (lysine methyltransferase) 7
    • SET domain containing protein 7
    • SET domain containing protein 8
    • SET domain-containing protein 7
    • SET7
    • SET7/9
    • SET9
    • Setd7
    • SETD7_HUMAN
    see all
  • Function
    Histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes such as collagenase or insulin. Recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. Has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins. Monomethylates 'Lys-189' of TAF10, leading to increase the affinity of TAF10 for RNA polymerase II. Monomethylates 'Lys-372' of p53/TP53, stabilizing p53/TP53 and increasing p53/TP53-mediated transcriptional activation. Also able to demethylated 'Lys-372' of p53/TP53 in vitro.
  • Tissue specificity
    Widely expressed. Expressed in pancreatic islets.
  • Sequence similarities
    Belongs to the histone-lysine methyltransferase family. SET7 subfamily.
    Contains 3 MORN repeats.
    Contains 1 SET domain.
  • Domain
    The SET domain is necessary but not sufficient for histone methyltransferase activity.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • SDS Page analysis of ab167960
  • The specific activity of ab167960 was determined to be 40 nmol/min/mg as per activity assay protocol.

References

ab167960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up