Recombinant Human seven transmembrane helix receptor protein (ab89350)

Overview

  • Product nameRecombinant Human seven transmembrane helix receptor protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMGTGSDARPRVRPWPHRAAARRATARARSPPPRSPGSGQGPRDLRSRGPT ARCCA SRPGLGFGPGPLTHPTTARPKSWCFLRAAVPTSPGTRQRKHGR HRRQSPRPALRP KSLLHTGADKTKWPPRGRLPSMPCARGTRPGPGGEG ELGFRRPGAGPAEAG

Specifications

Our Abpromise guarantee covers the use of ab89350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab89350 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • RelevanceSeven transmembrane helix receptor may be a member of the G protein coupled receptor family. The specific function of this protein is unknown.
  • Cellular localizationMembrane

References for Recombinant Human seven transmembrane helix receptor protein (ab89350)

ab89350 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"