Overview

  • Product name
    Recombinant Human SEZ6L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPAARPPAAGLRGISLFLALLLGSPAAALERDALPEGDASPLGPYLLPSG APERGSPGKEHPEERVVTAPPSSSQSAEVLGELVLDGTAPSAHHDIPALS PLLPEEARPKHALPPKKKLPSLKQVNSARKQLRPKATSAATVQRAGSQPA SQGLDLLSSSTEKPGPPGDPDPIVASEEASEVPLWLDRKESAVPTTPAPL QISPFTSQPYVAHTLPQRPEPGEPGPDMAQEAPQEDTSPMALMDKGENEL TGSASEESQETTTSTIITTTVITTEQAPALCSVSFSNPEGYIDSSDYPLL PLNNFLECTYNVTVYTGYGVELQVKSVNLSDGELLSIRGVDGPTLTVLAN QTLLVEGQVIRSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCNFPRRPD SGDVTVMDLHSGGVAHFHCHLGYELQGAKMLTCINASKPHWSSQEPICSA PCGGAVHNATIGRVLSPSYPENTNGSQFCIWTIEAPEGQKLHLHFERLLL HDKDRMTVHSGQTNKSALLYDSLQTESVPFEGLLSEGNTIRIEFTSDQAR AASTFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIVEFTCDPGHSL EQGPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVE GEDCIWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGN SGPQKLYSSTPDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPE IQNGWKTTSHTELVRGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFC EKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLLTCYS RETGTPIWTSRLPHCVLAEAAAETSLEGGNMALAIFIPVLIISLLLGGAY IYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYEVSI
    • Amino acids
      1 to 948
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0927
    • OTTHUMP00000198648
    • OTTHUMP00000198649
    • Seizure 6 like protein
    • Seizure related 6 homolog (mouse) like
    • Seizure related 6 homolog likeprovided
    • Seizure related gene 6 (mouse) like
    • Seizure related gene 6 like
    see all
  • Relevance
    SEZ6L is a candidate tumor suppressor gene. This protein may contribute to specialized endoplasmic reticulum functions in neurons
  • Cellular localization
    Endoplasmic reticulum membrane; Single-pass type I membrane protein

Images

  • ab161680 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up