Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKE QRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFS
    • Amino acids
      140 to 227
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160932 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Pre mRNA processing 21
    • Pre mRNA splicing factor SF3a
    • PRP21
    • PRPF21
    • SAP 114
    • SAP114
    • sf3a1
    • SF3A1_HUMAN
    • SF3a120
    • Spliceosome associated protein 114
    • Spliceosome-associated protein 114
    • Splicing factor 3 subunit 1
    • Splicing factor 3A subunit 1
    • Splicing factor 3a subunit 1 120kDa
    see all
  • Function
    Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Contains 2 SURP motif repeats.
    Contains 1 ubiquitin-like domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160932 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160932 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160932.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up