Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFL SEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEID EKLLYDTFSA
    • Amino acids
      13 to 122
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AFD1
    • Hsh49
    • MGC10828
    • Pre mRNA splicing factor SF3b 49 kDa subunit
    • Pre-mRNA-splicing factor SF3b 49 kDa subunit
    • SAP 49
    • SAP49
    • Sf3b4
    • SF3B4_HUMAN
    • SF3b49
    • SF3b50
    • Spliceosomal protein
    • Spliceosome associated protein (U2 snRNP)
    • Spliceosome associated protein 49
    • Spliceosome-associated protein 49
    • Splicing factor 3B subunit 4
    • Splicing factor 3b subunit 4 49kDa
    see all
  • Information by UniProt

Images

  • ab160910 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up