Recombinant Human SFMBT1 protein (ab153353)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLEC QAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVG WAAQQGYELQ
    • Amino acids
      121 to 230
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434L243
    • MGC93349
    • OTTMUSP00000030378
    • OTTMUSP00000030379
    • OTTMUSP00000030381
    • Renal ubiquitous protein 1
    • RU1
    • Scm like with four mbt domains 1
    • Scm like with four MBT domains protein 1
    • Scm related gene containing four mbt domains
    • Scm related gene product containing four mbt domains
    • Scm-like with four MBT domains protein 1
    • SFMBT
    • SFMBT 1
    • Sfmbt1
    • SMBT1_HUMAN
    • Smr
    see all
  • Tissue specificity
    Expressed in all cell lines and normal tissues tested, including the thymus.
  • Sequence similarities
    Contains 4 MBT repeats.
    Contains 1 SAM (sterile alpha motif) domain.
  • Information by UniProt

Images

  • ab153353 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153353 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up