Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ6FHJ7
    • SpeciesHuman
    • SequenceCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYE WRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSR SN
    • Molecular weight37 kDa including tags
    • Amino acids211 to 312

Specifications

Our Abpromise guarantee covers the use of ab114483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Frizzled protein
    • Frizzled protein human endometrium
    • FRP 4
    • FRP4
    • FrpHE
    • human endometrium
    • Secreted frizzled-related protein 4
    • sFRP-4
    • Sfrp4
    • SFRP4_HUMAN
    see all
  • FunctionSoluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP4 may act as a regulator of adult uterine morphology and function. Increases apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity). Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake.
  • Tissue specificityExpressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In ovarian tumors, expression levels are inversely correlated with expression of CTNNB1 (at protein level).
  • Sequence similaritiesBelongs to the secreted frizzled-related protein (sFRP) family.
    Contains 1 FZ (frizzled) domain.
    Contains 1 NTR domain.
  • DomainThe FZ domain is involved in binding with Wnt ligands.
  • Cellular localizationSecreted. Cytoplasmic in ovarian tumor cells.
  • Information by UniProt

Recombinant Human SFRP4 protein images

  • 12.5% SDS-PAGE showing ab114483 at approximately 36.85kDa stained with Coomassie Blue.

References for Recombinant Human SFRP4 protein (ab114483)

ab114483 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"