Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP84103
    • SpeciesHuman
    • SequenceMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAF VEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRP RDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRS FSRSRSRSRSNERK
    • Molecular weight44 kDa including tags
    • Amino acids1 to 164
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • arginine/serine-rich 3
    • Pre mRNA splicing factor SRP20
    • Pre-mRNA-splicing factor SRP20
    • Serine/arginine-rich splicing factor 3
    • Splicing factor
    • Splicing factor arginine/serine rich 20 kD
    • Splicing factor arginine/serine rich 3
    • SRp20
    • SRSF3
    • SRSF3_HUMAN
    • X16
    see all
  • FunctionMay be involved in RNA processing in relation with cellular proliferation and/or maturation.
  • Sequence similaritiesBelongs to the splicing factor SR family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Extensively phosphorylated on serine residues in the RS domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SFRS3 protein images

  • SDS-PAGE analysis of ab114674 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human SFRS3 protein (ab114674)

ab114674 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"