Overview

  • Product name
    Recombinant Human SFRS4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEF VSYSDMKRALEKLDGTEVNGRKIRLVE
    • Molecular weight
      34 kDa including tags
    • Amino acids
      98 to 174

Specifications

Our Abpromise guarantee covers the use of ab117053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • arginine/serine-rich 4
    • Pre mRNA splicing factor SRP75
    • Pre-mRNA-splicing factor SRP75
    • Serine/arginine-rich splicing factor 4
    • Splicing factor
    • Splicing factor, arginine/serine rich 4
    • Splicing factor, arginine/serine rich, 75-KD
    • SRP001LB
    • SRP75
    • Srsf4
    • SRSF4_HUMAN
    see all
  • Function
    A probable role in alternative splice site selection during pre-mRNA splicing.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Extensively phosphorylated on serine residues in the RS domain.
  • Cellular localization
    Nucleus speckle.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117053 at approximately 34.10 kDa.
    Stained with Coomassie Blue.

References

ab117053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up