Overview

  • Product name
    Recombinant Human SFRS4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEF VSYSDMKRALEKLDGTEVNGRKIRLVE
    • Molecular weight
      34 kDa including tags
    • Amino acids
      98 to 174

Specifications

Our Abpromise guarantee covers the use of ab117053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • arginine/serine-rich 4
    • Pre mRNA splicing factor SRP75
    • Pre-mRNA-splicing factor SRP75
    • Serine/arginine-rich splicing factor 4
    • Splicing factor
    • Splicing factor, arginine/serine rich 4
    • Splicing factor, arginine/serine rich, 75-KD
    • SRP001LB
    • SRP75
    • Srsf4
    • SRSF4_HUMAN
    see all
  • Function
    A probable role in alternative splice site selection during pre-mRNA splicing.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Extensively phosphorylated on serine residues in the RS domain.
  • Cellular localization
    Nucleus speckle.
  • Information by UniProt

Recombinant Human SFRS4 protein images

  • 12.5% SDS-PAGE showing ab117053 at approximately 34.10 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human SFRS4 protein (ab117053)

ab117053 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up