Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFST NRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGG FEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQRIQVYLSLLSL LLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAV IYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAIPTIVSDGNTT FQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSE CEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNS ASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG QLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGISRM ITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTKP IPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGI ILVTVAVFCHAYFA
    • Molecular weight
      100 kDa
    • Amino acids
      1 to 664

Specifications

Our Abpromise guarantee covers the use of ab152683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D22S675
    • High affinity sodium glucose cotransporter
    • High affinity sodium glucose cotransporter 1
    • High affinity sodium-glucose cotransporter
    • Human Na+/glucose cotransporter 1
    • Na(+)/glucose cotransporter 1
    • Na+/glucose cotransporter 1
    • NAGT
    • SC5A1_HUMAN
    • SGLT 1
    • SGLT1
    • SLC5A1
    • Sodium glucose cotransporter 1
    • Sodium/glucose cotransporter 1
    • Solute carrier family 5 (sodium/glucose cotransporter) member 1
    • Solute carrier family 5 member 1
    see all
  • Function
    Actively transports glucose into cells by Na(+) cotransport with a Na(+) to glucose coupling ratio of 2:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
  • Tissue specificity
    Expressed mainly in intestine and kidney.
  • Involvement in disease
    Congenital glucose/galactose malabsorption
  • Sequence similarities
    Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
  • Post-translational
    modifications
    N-glycosylation is not necessary for the cotransporter function.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152683 stained with Coomassie Blue.

References

ab152683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up