Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
    • Molecular weight
      31 kDa including tags
    • Amino acids
      228 to 277

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Low affinity sodium glucose cotransporter
    • Low affinity sodium-glucose cotransporter
    • Na(+) glucose cotransporter 2
    • Na(+)/glucose cotransporter 2
    • OTTHUMP00000163298
    • SC5A2_HUMAN
    • SGLT 2
    • SLC5A 2
    • SLC5A2
    • Sodium glucose cotransporter 2
    • Sodium/glucose cotransporter 2
    • Solute carrier family 5 (sodium glucose cotransporter) member 2
    • Solute carrier family 5 (sodium/glucose transporter), member 2
    • Solute carrier family 5 member 2
    see all
  • Function
    Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.
    Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
  • Involvement in disease
    Defects in SLC5A2 are the cause of renal glucosuria (GLYS1) [MIM:233100]. GLYS1 is an autosomal recessive disorder characterized by a normal fasting serum glucose concentration and persistent isolated glucosuria, with a normal glucose tolerance test.
  • Sequence similarities
    Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human SGLT2 protein images

  • ab114508 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human SGLT2 protein (ab114508)

ab114508 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up