Recombinant Human SH3BGRL protein (ab114874)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75368
    • SpeciesHuman
    • SequenceMVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMR ENVPENSRPATGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAP PGSKEAEVQAKQQA
    • Molecular weight39 kDa including tags
    • Amino acids1 to 114

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC 117402
    • OTTHUMP 00000023609
    • SH3 binding domain glutamic acid rich protein like
    • SH3 domain binding glutamic acid rich protein like
    • SH3 domain-binding glutamic acid-rich-like protein
    • SH3BGR
    • SH3BGRL
    • SH3L1_HUMAN
    see all
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the SH3BGR family.
  • Information by UniProt

Recombinant Human SH3BGRL protein images

  • 12.5% SDS-PAGE showing ab114874 at approximately 38.65kDa.
    Stained with Coomassie Blue.

References for Recombinant Human SH3BGRL protein (ab114874)

ab114874 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"