Recombinant Human SH3BGRL protein (ab114874)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMR ENVPENSRPATGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAP PGSKEAEVQAKQQA
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 114

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC 117402
    • OTTHUMP 00000023609
    • SH3 binding domain glutamic acid rich protein like
    • SH3 domain binding glutamic acid rich protein like
    • SH3 domain-binding glutamic acid-rich-like protein
    • SH3BGR
    • SH3BGRL
    • SH3L1_HUMAN
    see all
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the SH3BGR family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114874 at approximately 38.65kDa.
    Stained with Coomassie Blue.

References

ab114874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up