Recombinant Human SH3BP4 protein (ab161745)

Overview

  • Product name
    Recombinant Human SH3BP4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDN PTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTE MGYIPSSYVQ
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BOG25
    • EH binding protein
    • EH binding protein 10
    • EH-binding protein 10
    • EHB10
    • SH3 domain binding protein 4
    • SH3 domain-binding protein 4
    • SH3B4_HUMAN
    • sh3bp4
    • Transferrin receptor trafficking protein
    • Transferrin receptor-trafficking protein
    • TTP
    see all
  • Function
    Functions in transferrin receptor internalization at the plasma membrane through a cargo-specific control of clathrin-mediated endocytosis.
  • Tissue specificity
    Expressed in all tissues tested with higher expression in pancreas. Expressed by retinal pigment epithelial cells (at protein level).
  • Sequence similarities
    Contains 1 SH3 domain.
  • Domain
    The SH3 domain mediates localization to the clathrin-coated pits and vesicles. The SH3 domain mediates interaction with DNM2 and the cytoplasmic part of TFRC with a lower affinity.
  • Post-translational
    modifications
    Phosphorylated upon EGF stimulation. Phosphorylation prevents interaction with DNM2.
  • Cellular localization
    Membrane > clathrin-coated pit. Cytoplasmic vesicle > clathrin-coated vesicle. Nucleus. Specifically associated with transferrin receptor-containing clathrin-coated pits and clathrin-coated vesicles. May also localize to the nucleus.
  • Information by UniProt

Images

  • ab161745 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up